PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004499514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41862.1 Da    PI: 8.7259
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004499514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.65.2e-212067249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    + e ++n+qvtfskRr g++KK +EL++LC++++a+i+fs+ +kl+ +
  XP_004499514.1 20 KLEKDTNKQVTFSKRRSGLFKKTSELCILCNVDAAIIVFSPADKLFCF 67
                    56899***************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-301170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.8661171IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-261283IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-191333IPR002100Transcription factor, MADS-box
PfamPF003191.9E-212167IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-193348IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-194869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNIFKQKKKT TGRKKIEIKK LEKDTNKQVT FSKRRSGLFK KTSELCILCN VDAAIIVFSP  60
ADKLFCFGQP NTDTIINSYI KGTTEFEASK SIEKSIFYEE HNTEYEEAIH KLEFEKKKLE  120
EFENLSKVWK SGDWWNDPID EMSIDQLEQF MASIYELRRK LVDRVDDLVM MLPRLYFYFV  180
CTSHTTVNTL FYELGKLQSV LRIRDNTLEH VAAFRVSEIY VLDANLNSGF KLQRHVESTV  240
YQSHAKVTGQ HGAWKASGCS NSIAFRHITQ MLYFKVLHFQ KARENKTRKR LIATSDGTPS  300
EASTPFGCVH LELQVVSSLT PLQFLLIIPQ VDMPLLDVLV NVAERSAVSA SKGSSATLYA  360
PAVDPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-131279168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-131279168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-131279168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-131279168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P2e-131279269Myocyte-specific enhancer factor 2B
1tqe_Q2e-131279269Myocyte-specific enhancer factor 2B
1tqe_R2e-131279269Myocyte-specific enhancer factor 2B
1tqe_S2e-131279269Myocyte-specific enhancer factor 2B
3mu6_A8e-141279168Myocyte-specific enhancer factor 2A
3mu6_B8e-141279168Myocyte-specific enhancer factor 2A
3mu6_C8e-141279168Myocyte-specific enhancer factor 2A
3mu6_D8e-141279168Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004499514.10.0PREDICTED: MADS-box transcription factor 20-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-26AGAMOUS-like 62